FCCC    Clusters of Antibody CDR Loop Conformations     Dunbrack Lab
 

CDRs for query 5V8L


#CDRs = 6; #Clusters = 12.
ChainGenePDB SpeciesFrame GermlineFrame %CDR GermlineCDR %CDRLengthClusterDistance(°)SequenceRamachandran
GNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0146.2H113H1-13-230EASGYNIRDYFIHBPPAPPAAABPPB
GNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0140H210H2-10-118WINPKTGQPNBBPAADLPPB
GNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV-1H312H3-12-*-1ARQRSDYWDFDVBBPABAALPBAB
HNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0146.2H113H1-13-132EASGYNIRDYFIHBPBAPPAAABPPB
HNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0140H210H2-10-117WINPKTGQPNBBPAADLPPB
HNAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV-1H312H3-12-*-1ARQRSDYWDFDVBBPABADLPBAB
INAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0146.2H113H1-13-133EASGYNIRDYFIHBPBAPPAAABPPB
INAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV1-46*0140H210H2-10-119WINPKTGQPNBBPADALPPB
INAHomo.sapiensHu_IGHV1-46*0164.9Hu_IGHV-1H312H3-12-*-1ARQRSDYWDFDVBBPABAALPBAB
JNAHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV1-8*0146.2H113H1-13-339KASGNSFSNHDVHBBPLLAAADBPPB
JNAHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV1-8*0140H210H2-10-216WMSHEGDKTGBBPAALABBB
JNAHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV-1H333H3-33-*-1LTGSKHRLRDYFLYNEYGPNYEEWGDYLATLDVBPBBBBBBPABBBPBADBPPPBBBBBBPDBPPP
KNAHomo.sapiensHu_IGKV1D-33*0179.7CDRLenMismatch-1L17L1-7-*-1QANGYLNBBPGPBB
KNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV1D-33*0162.5L28L2-8-124YDGSKLERPLLDBPPP
KNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV-1L36L3-6-*-1QVYEFVBBADPB
LNAHomo.sapiensHu_IGKV1D-33*0179.7CDRLenMismatch-1L17L1-7-*-1QANGYLNBBPGPBB
LNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV1D-33*0162.5L28L2-8-129YDGSKLERBLLDPPPP
LNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV-1L36L3-6-*-1QVYEFVBBADPB
MNAHomo.sapiensHu_IGKV1D-33*0179.7CDRLenMismatch-1L17L1-7-*-1QANGYLNBBPGPBB
MNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV1D-33*0162.5L28L2-8-124YDGSKLERBLLDPPPP
MNAHomo.sapiensHu_IGKV1D-33*0179.7Hu_IGKV-1L36L3-6-*-1QVYEFVBBADPB
NNAHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV2D-28*0156.2L116L1-16-116KCSHSLQHSTGANYLABBABPAPBAALPBBBB
NNAHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV2D-28*0150L28L2-8-124HLATHRASBLLDBPPP
NNAHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV-1L39L3-9-cis7-112MQGLHSPWTBBDABPpPB