FCCC    Clusters of Antibody CDR Loop Conformations     Dunbrack Lab
 

CDRs for query 5UXQ


#CDRs = 6; #Clusters = 6.
ChainGenePDB SpeciesFrame GermlineFrame %CDR GermlineCDR %CDRLengthClusterDistance(°)SequenceRamachandran
ANAHomo.sapiensHu_IGHV1-8*0180.3Hu_IGHV1-8*0130H210H2-10-216WMSHEGDKTEBBPAALABBB
ANAHomo.sapiensHu_IGHV1-8*0180.3Hu_IGHV-1H334H3-34-*-1TRGSKHRLRDYVLYDDYGLINYQEWNDYLEFLDVBPBBBBBBPABBBBBAALAPBPBPBBBBPABBDP
BNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV2D-28*0168.8L116L1-16-119TSTQSLRHSNGANYLABPDPPDPPAALPPPBB
BNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV2D-28*0175L28L2-8-19RLGSQRASBLLDPPPP
BNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV-1L39L3-9-cis7-117MQGLNRPWTBPDAPPpPB
HNAHomo.sapiensHu_IGHV1-8*0180.3Hu_IGHV1-8*0161.5H113H1-13-317KASGNTFSKYDVHBBPGDAADABPBB
HNAHomo.sapiensHu_IGHV1-8*0180.3Hu_IGHV1-8*0130H210H2-10-215WMSHEGDKTEBBPAALABBB
HNAHomo.sapiensHu_IGHV1-8*0180.3Hu_IGHV-1H334H3-34-*-1TRGSKHRLRDYVLYDDYGLINYQEWNDYLEFLDVBBBBBBPBPABBBBBADLDBBBBPBBPBPABBAB
LNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV2D-28*0168.8L116L1-16-116TSTQSLRHSNGANYLABBABPDPPAALPPPBB
LNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV2D-28*0175L28L2-8-18RLGSQRASBLLDPPPP
LNAHomo.sapiensHu_IGKV2D-28*0182.3Hu_IGKV-1L39L3-9-cis7-116MQGLNRPWTBPDAPBpPB