FCCC    Clusters of Antibody CDR Loop Conformations     Dunbrack Lab
 

CDRs for query 3U1S


#CDRs = 6; #Clusters = 6.
ChainGenePDB SpeciesFrame GermlineFrame %CDR GermlineCDR %CDRLengthClusterDistance(°)SequenceRamachandran
HheavyHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV1-8*0146.2H113H1-13-337KASGNSFSNHDVHBBPLLAAADBPBB
HheavyHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV1-8*0140H210H2-10-218WMSHEGDKTGBBPAALDBBB
HheavyHomo.sapiensHu_IGHV1-8*0180.8Hu_IGHV-1H333H3-33-*-1LTGSKHRLRDYFLYNEYGPNYEEWGDYLATLDVBPBBBBBBPABBBPBADBPPPBBBBBBPABPDP
LkappaHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV2D-28*0156.2L116L1-16-110KCSHSLQHSTGANYLABBABPDPPAALPBPBB
LkappaHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV2D-28*0150L28L2-8-19HLATHRASBLLDPPPP
LkappaHomo.sapiensHu_IGKV2D-28*0181.4Hu_IGKV-1L39L3-9-cis7-114MQGLHSPWTBPDAPPpPB