FCCC    Clusters of Antibody CDR Loop Conformations     Dunbrack Lab
 

CDRs for query 5UY3


#CDRs = 6; #Clusters = 7.
ChainGenePDB SpeciesFrame GermlineFrame %CDR GermlineCDR %CDRLengthClusterDistance(°)SequenceRamachandran
ANAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV1-8*0161.5H113H1-13-*-1KASGNTFRKYDVHBPPLLPDADBPBB
ANAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV1-8*0130H210H2-10-220WMSHEGDKTEBBPAALDBBB
ANAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV-1H334H3-34-*-1TGGSKHRLRDYVLYDDYGLINQQEWNDYLEFLDVBPBBPBPBPABBBBPADLBPABBBBBPBPABBBL
BNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV2D-28*0168.8L116L1-16-117TSTQSLRHSNGANYLABBABPAPPAALBPPBB
BNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV2D-28*0175L28L2-8-19RLGSQRASBLLDPPPP
BNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV-1L39L3-9-cis7-115MQGLNRPWTBPDAPBpPB
HNAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV1-8*0161.5H113H1-13-318KASGNTFRKYDVHBBPGBAADABPBB
HNAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV1-8*0130H210H2-10-219WMSHEGDKTEBBPAALDBBB
HNAHomo.sapiensHu_IGHV1-8*0177.1Hu_IGHV-1H334H3-34-*-1TGGSKHRLRDYVLYDDYGLINQQEWNDYLEFLDVBPBBBBPBPDBBBBPAALPPABBBBBPBPABBBL
LNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV2D-28*0168.8L116L1-16-122TSTQSLRHSNGANYLABBAPPDPPAALPPBBB
LNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV2D-28*0175L28L2-8-114RLGSQRASBLLDPPPP
LNAHomo.sapiensHu_IGKV2D-28*0180.9Hu_IGKV-1L39L3-9-cis7-116MQGLNRPWTBPDAPPpPB